PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00380g00618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 402aa    MW: 44316.9 Da    PI: 7.2078
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00380g00618.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.2e-32227282156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Peaxi162Scf00380g00618.1 227 KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 282
                               79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.875224284IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-29225285IPR009057Homeodomain-like
SuperFamilySSF466893.14E-18225285IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-28227282IPR006447Myb domain, plants
PfamPF002498.1E-8229280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MMINNNHDNR TEKMQRCQQY IDALEEERTK IQVFSRELPL CLELVTQAIE TYKQQLSGTT  60
TETYNLNAHE SDQCSEQTCS DHVPILEEFI PLKRTCSEED EEEEDDDNER VSHKSKTTNT  120
SNTSTSSKNN DKCCKKSDWL RSVQLWNQTS DPTPKEEVTP RQVSVMEVKK NGSGGAFHPF  180
KKEKSASNSA AAAAESPTLT VIPAAAASST AESGGGSKKE DKDSQRKQRR CWSPELHRRF  240
LQALQQLGGS HVATPKQIRE LMKVDGLTND EVKSHLQKYR LHTRRPSPSI HNNNNQQPPQ  300
FVVVGGIWVP PPEYAAMAAA APAASGEASG VAHSNGIYAP IATLPKGPFQ DGTLKQRQHI  360
SNKPLRRSEE RGCGSHSDGG VHSNSPATSN SSTHTTTASP AY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548806.10.0PREDICTED: transcription factor LUX
TrEMBLK4BXE61e-169K4BXE6_SOLLC; Uncharacterized protein
STRINGSolyc05g009720.2.11e-169(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.15e-78G2-like family protein